PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010653-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 288aa    MW: 32436.7 Da    PI: 6.6572
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010653-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed++l+d+++ +G g Wk  +++ g++R++k+c++rw++yl
    NNU_010653-RA 14 RGAWTVYEDQILIDYITTHGDGKWKELPKKAGLNRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding50.83.9e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ ++eE+el+ +++++lG++ W++Ia +++ gRt++++k++w++
    NNU_010653-RA  67 RGNISAEEEELIMRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110
                      7899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.72961IPR017930Myb domain
SuperFamilySSF466891.64E-2812108IPR009057Homeodomain-like
SMARTSM007175.7E-121363IPR001005SANT/Myb domain
PfamPF002491.7E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-231568IPR009057Homeodomain-like
CDDcd001672.68E-91661No hitNo description
PROSITE profilePS5129425.15862116IPR017930Myb domain
SMARTSM007176.0E-1566114IPR001005SANT/Myb domain
PfamPF002492.5E-1467110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-2569116IPR009057Homeodomain-like
CDDcd001673.18E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRSPCCVKE GLNRGAWTVY EDQILIDYIT THGDGKWKEL PKKAGLNRCG KSCRLRWLNY  60
LRPGIKRGNI SAEEEELIMR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT SLSKKLRAGD  120
QTPEKQVVIN KSKGKKMVEA AGNSALSTLS SKVSQEPPRV IRTKAVRCTR VFFPPQQGSE  180
CHHVDETMIN KREEPALASS SSGFNCTPST LSSIIQADGD YSNFLTDLDI GELLSMPDFL  240
QFCSEGIDHQ ENDNVIMDGE DLPWFSDYPF SAPYEIMLPE STDDRCNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262233.10.0PREDICTED: transcription repressor MYB6-like
SwissprotP102903e-64MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLG9B6Q42e-80G9B6Q4_JATCU; R2R3 MYB transcription factor
STRINGVIT_11s0016g01320.t018e-80(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-62MYB family protein